PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10024347
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family M-type_MADS
Protein Properties Length: 191aa    MW: 21519.4 Da    PI: 10.2601
Description M-type_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10024347genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF42.21e-136441250
                 HHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
       SRF-TF 12 tfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
                  + kRr ++ KKA ELS+LC+++va + f ++g + +++
  Lus10024347  6 QLKKRRRTLKKKAAELSTLCGIDVAYVCFEPNGGVDTWP 44
                 578***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5006610.834147IPR002100Transcription factor, MADS-box
SuperFamilySSF554551.44E-14266IPR002100Transcription factor, MADS-box
PfamPF003193.7E-13343IPR002100Transcription factor, MADS-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 191 aa     Download sequence    Send to blast
MSRSPQLKKR RRTLKKKAAE LSTLCGIDVA YVCFEPNGGV DTWPEDPNKV KDIILKYRQV  60
KSVEKYPDST AAAAPGSSQT YSDVTQNDGG GGEIQEPLKK LQDWLSRHNQ LSQEQLAGAY  120
RFADKKIKSI RRRMASLKPD EQTLERRRRR TKDRSEASKL IDFVGSWPAS SQPEQTTCRF  180
SDSSPLRIVC *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
11016RRTLKKK
2130149RRRMASLKPDEQTLERRRRR
3145150RRRRRT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18650.14e-09AGAMOUS-like 103